PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0018s0222.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 314aa    MW: 34259.4 Da    PI: 6.8907
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0018s0222.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.49.6e-19234267134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          Cs+C++ kTp+WR gp+g ktLCnaCG+++++ +
  Kaladp0018s0222.2.p 234 CSHCQVQKTPQWRAGPEGAKTLCNACGVRFKSGR 267
                          *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.5E-7328310IPR016679Transcription factor, GATA, plant
SMARTSM004011.3E-16228282IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.611228264IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.09E-14229291No hitNo description
Gene3DG3DSA:3.30.50.103.5E-15231265IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.88E-13233281No hitNo description
PROSITE patternPS003440234259IPR000679Zinc finger, GATA-type
PfamPF003201.1E-16234267IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEYCIEARAL KPSMRREIDV RPNQSLAVDE FVYETEAHGG GFVEDFLIDD LLDFPEKEVV  60
EEEKDSLSGC SAELETDENG NSTVTGEGDF LSQADDAAAG LAVPDDLADL EWVSRFVDDT  120
MPEFPPLYNS RKDKSGVSGR KSSGVGSLPV QLKQPRQIEP LTIPAKPRTK RRRIGRVWSL  180
NSSAASESST ASSSISSSSI ISIPLQFGFR KPLAKKQKTN SEPVQPGDST GRRCSHCQVQ  240
KTPQWRAGPE GAKTLCNACG VRFKSGRLYP EYRPACSPTF RSDVHSNSHR KVLEMRKKKE  300
VGTGGSGLAV QSC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169173KRRRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016186938.12e-71PREDICTED: GATA transcription factor 5-like
TrEMBLD9ZIZ01e-72D9ZIZ0_MALDO; GATA domain class transcription factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-50GATA transcription factor 5